PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 308aa    MW: 32749.2 Da    PI: 6.7986
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00929.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM65.41.7e-20231508126
             NAM   8 hPtdeelvveyLkkkvegkk...leleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknra..tksgyWkatgkdkev 92 
                     hP++eel++ +L+++++++     +    ++++d+y++ P +L +      + ++++ wyfFs  + k++ g+r+ r+  t  g W++    k+v
  Pahal.G00929.1  23 HPSEEELITSFLRPRLAADGsggAPR-ALVHDADVYSAGPDELTRvfdpaVAGNGDRAWYFFSAVRAKTSDGQRRARTvgTGGGCWHSEAGAKPV 116
                     9**************99888554333.56**************85467755666899********************63477999********** PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmhey 126
                     ++  g+  g ++++ f ++   + +++ W+m e 
  Pahal.G00929.1 117 VDGAGRCLGHRRSFSFVTKAGGQRVRSGWLMVEL 150
                     **9**************99999999******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.39216166IPR003441NAC domain
PfamPF023654.6E-1221150IPR003441NAC domain
SuperFamilySSF1019413.14E-2923166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MVVATRRTTA AHPTPPRPDL AAHPSEEELI TSFLRPRLAA DGSGGAPRAL VHDADVYSAG  60
PDELTRVFDP AVAGNGDRAW YFFSAVRAKT SDGQRRARTV GTGGGCWHSE AGAKPVVDGA  120
GRCLGHRRSF SFVTKAGGQR VRSGWLMVEL GLDDADGVAL CKIYFSPRAR TSGGAASAAS  180
SAGRKRKQAA AGDPAASSRR GRRSTEAGAP RRDDAVTADA ESTQDGGGLA DESSASSDDE  240
DEDGLWKEGM FLSWWMRNRD RLVEEHGIVD RSDEELQKTL GLDKVMKLLN RDYGDSLLIK  300
PSAPENP*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458311.13e-97hypothetical protein SORBIDRAFT_03g031000
TrEMBLK3XS061e-100K3XS06_SETIT; Uncharacterized protein
STRINGSi004703m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.14e-14NAC domain containing protein 102